Structure of PDB 4atk Chain A Binding Site BS01

Receptor Information
>4atk Chain A (length=60) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNHNLIERRRRFNINDRIKELGTLIPKDPDMRWNKGTILKASVDYIRKLQ
REQQRAKDLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4atk Restricted Leucine Zipper Dimerization and Specificity of DNA Recognition of the Melanocyte Master Regulator Mitf
Resolution2.95 Å
Binding residue
(original residue number in PDB)		H209 N210 R240 K243
Binding residue
(residue number reindexed from 1)		H3 N4 R32 K35
Binding affinityPDBbind-CN: Kd=1.7nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:4atk, PDBe:4atk, PDBj:4atk
PDBsum4atk
PubMed23207919
UniProtQ08874|MITF_MOUSE Microphthalmia-associated transcription factor (Gene Name=Mitf)

[Back to BioLiP]