Structure of PDB 4alp Chain A Binding Site BS01

Receptor Information
>4alp Chain A (length=87) Species: 8364 (Xenopus tropicalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPQVLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEG
FRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4alp The Lin28 Cold-Shock Domain Remodels Pre-Let-7 Microrna.
Resolution1.48 Å
Binding residue
(original residue number in PDB)		G45 Q69 F77 R78
Binding residue
(residue number reindexed from 1)		G19 Q43 F51 R52
Binding affinityPDBbind-CN: Kd=2760nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:4alp, PDBe:4alp, PDBj:4alp
PDBsum4alp
PubMed22570413
UniProtB4F6I0

[Back to BioLiP]