Structure of PDB 4al6 Chain A Binding Site BS01

Receptor Information
>4al6 Chain A (length=157) Species: 208963 (Pseudomonas aeruginosa UCBPP-PA14) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLD
ESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYR
QVSRVQAALDLPFVTLRAQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSK
GGFVPWF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4al6 Csy4 Relies on an Unusual Catalytic Dyad to Position and Cleave Crispr RNA.
Resolution2.63 Å
Binding residue
(original residue number in PDB)		H29 R102 Q104 Q149 Q153 F155 C175 Y176
Binding residue
(residue number reindexed from 1)		H31 R104 Q106 Q119 Q123 F125 C145 Y146
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4al6, PDBe:4al6, PDBj:4al6
PDBsum4al6
PubMed22522703
UniProtQ02MM2|CAS6_PSEAB CRISPR-associated endonuclease Cas6/Csy4 (Gene Name=cas6f)

[Back to BioLiP]