Structure of PDB 4al5 Chain A Binding Site BS01

Receptor Information
>4al5 Chain A (length=189) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTMDHYLDIRLRPDPEFPPAQLMCVLFGKLHQALVAQGGDRIGVSFPDLD
ESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYR
QVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRS
QSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4al5 Csy4 Relies on an Unusual Catalytic Dyad to Position and Cleave Crispr RNA.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R102 Q104 S107 N108 R111 R114 R115 R119 H120 R130 I131 V135 A138 L139 S148 Q149 S150 T151 Q153 F155 R156 F158 Y176
Binding residue
(residue number reindexed from 1)		R104 Q106 S109 N110 R113 R116 R117 R121 H122 R132 I133 V137 A140 L141 S150 Q151 S152 T153 Q155 F157 R158 F160 Y178
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4al5, PDBe:4al5, PDBj:4al5
PDBsum4al5
PubMed22522703
UniProtQ02MM2|CAS6_PSEAB CRISPR-associated endonuclease Cas6/Csy4 (Gene Name=cas6f)

[Back to BioLiP]