Structure of PDB 4akt Chain A Binding Site BS01

Receptor Information

>4akt Chain A (length=330) Species: 1216 (Prochloron didemni) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VALHPHDLDERIPGLADLHNQTLGDPQITIVIIDGDPDYTLSCFEGAEVS
KVFPYWHEPAEPITPEDYAAFQSIRDQGLKGKEKEEALEAVIPDTKDRIV
LNDAACHVTSTIVGQEHSPVFGIAPNCRVINMPQDADVMSPLNLARAIDL
ALELGANIIHCAFCRPTQTSEGEEILVQAIKKCQDNNVLIVSPTGNNSNE
SWCLPAVLPGTLAVGAAKVDGTPCHFSNWGGNNTKEGILAPGEEILGAQP
CTEEPVRLTGTSMAAPVMTGISALLMSLQVQQGKPVDAEAVRTALLKTAI
PCDPEVVEEPERCLRGFVNIPGAMKVLFGQ

Ligand information

>4akt Chain C (length=9) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PIPFPAYDG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4akt The Mechanism of Patellamide Macrocyclization Revealed by the Characterization of the Patg Macrocyclase Domain.
Resolution	2.63 Å
Binding residue (original residue number in PDB)	K594 K598 N717 H746 F747 T780 S783 M784
Binding residue (residue number reindexed from 1)	K80 K84 N196 H225 F226 T259 S262 M263

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0008236	serine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4akt, PDBe:4akt, PDBj:4akt
PDBsum	4akt
PubMed	22796963
UniProt	Q52QJ1

[Back to BioLiP]