Structure of PDB 4aij Chain A Binding Site BS01

Receptor Information
>4aij Chain A (length=139) Species: 633 (Yersinia pseudotuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQL
AKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQ
VDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4aij Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		S48 Q49 Q60 P61 V64 R86 A87 K88
Binding residue
(residue number reindexed from 1)		S46 Q47 Q58 P59 V62 R84 A85 K86
Binding affinityPDBbind-CN: Kd=46nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4aij, PDBe:4aij, PDBj:4aij
PDBsum4aij
PubMed22936808
UniProtB1JJ73|SLYA_YERPY Transcriptional regulator SlyA (Gene Name=slyA)

[Back to BioLiP]