Structure of PDB 4abi Chain A Binding Site BS01

Receptor Information

>4abi Chain A (length=223) Species: 9913 (Bos taurus)

IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRL
GEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRV
ASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKS
AYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQK
NKPGVYTKVCNYVSWIKQTIASN

Ligand information

>4abi Chain B (length=11) Species: 32630 (synthetic construct)

GRCTKSIPICF

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4abi Braces for the Peptide Backbone: Insights Into Structure-Activity Relation-Ships of Protease Inhibitor Mimics with Locked Amide Conformations
• Resolution: 1.55 Å
• Binding residue (original residue number in PDB): F39 H55 S93 N94 D186 S187 C188 Q189 G190 S192 S207 W208 G209
• Binding residue (residue number reindexed from 1): F24 H40 S78 N79 D171 S172 C173 Q174 G175 S177 S192 W193 G194

Enzymatic activity

• Catalytic site (original residue number in PDB): H55 D99 Q189 G190 D191 S192 G193
• Catalytic site (residue number reindexed from 1): H40 D84 Q174 G175 D176 S177 G178
• Enzyme Commision number: 3.4.21.4: trypsin.

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004252 serine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0008236 serine-type peptidase activity
• GO:0046872 metal ion binding
• GO:0097655 serpin family protein binding

Biological Process

• GO:0006508 proteolysis
• GO:0007586 digestion

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0097180 serine protease inhibitor complex

External links

• PDB: RCSB:4abi, PDBe:4abi, PDBj:4abi
• PDBsum: 4abi
• PubMed: 22374650
• UniProt: P00760|TRY1_BOVIN Serine protease 1 (Gene Name=PRSS1)