Structure of PDB 4aab Chain A Binding Site BS01

Receptor Information
>4aab Chain A (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSNYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4aab Non-Specific Protein-DNA Interactions Control I-Crei Target Binding and Cleavage.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D20 T46 Q47 K48 R51
Binding residue
(residue number reindexed from 1)		D19 T45 Q46 K47 R50
Enzymatic activity
Catalytic site (original residue number in PDB) G19 D20
Catalytic site (residue number reindexed from 1) G18 D19
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4aab, PDBe:4aab, PDBj:4aab
PDBsum4aab
PubMed22495931
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]