Structure of PDB 4a8x Chain A Binding Site BS01

Receptor Information
>4a8x Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYA
YVEFENPDEAEKALKHMDGGQIDGQEITATAVLAPWPR
Ligand information
>4a8x Chain B (length=27) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLDDLFRKTKGTPCIYWLPLTPEAIAE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a8x The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
Resolution1.9 Å
Binding residue
(original residue number in PDB)		H176 E179 I180 Y184 K221 H222 M223 G225 G226 Q227 D229
Binding residue
(residue number reindexed from 1)		H20 E23 I24 Y28 K65 H66 M67 G69 G70 Q71 D73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4a8x, PDBe:4a8x, PDBj:4a8x
PDBsum4a8x
PubMed22388736
UniProtQ15287|RNPS1_HUMAN RNA-binding protein with serine-rich domain 1 (Gene Name=RNPS1)

[Back to BioLiP]