Structure of PDB 4a0k Chain A Binding Site BS01

Receptor Information
>4a0k Chain A (length=719) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKLVIKNFRDRPRLPDNYTQDTWRKLHEAVRAVQSSTSIRYNLEELYQAV
ENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQ
DHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQS
KTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETN
CLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACV
EKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHW
SEYIKTFGTAIVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLM
KESFETFINKRPNKPAELIAKHVDSKLRAGNKEATDEELERTLDKIMILF
RFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSK
LEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPME
VHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQ
VSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLI
KSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQ
DRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLI
DRDYMERDKDNPNQYHYVA
Ligand information
>4a0k Chain B (length=21) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKRFEVKKWNAVALWAWDIVV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4a0k The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
Resolution5.93 Å
Binding residue
(original residue number in PDB)		D522 L523 T524 N526 I527 L528 T529 M530 M547 L550 K566 L567 Q568 W569 Q570 L573 H575 A576 V577 L578 K579 A580 E581 L599 N603 F656
Binding residue
(residue number reindexed from 1)		D482 L483 T484 N486 I487 L488 T489 M490 M507 L510 K526 L527 Q528 W529 Q530 L533 H535 A536 V537 L538 K539 A540 E541 L559 N563 F616
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0061630 ubiquitin protein ligase activity
GO:0160072 ubiquitin ligase complex scaffold activity
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0001701 in utero embryonic development
GO:0006281 DNA repair
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0006974 DNA damage response
GO:0007283 spermatogenesis
GO:0008283 cell population proliferation
GO:0008284 positive regulation of cell population proliferation
GO:0016567 protein ubiquitination
GO:0030097 hemopoiesis
GO:0030853 negative regulation of granulocyte differentiation
GO:0034644 cellular response to UV
GO:0035019 somatic stem cell population maintenance
GO:0042110 T cell activation
GO:0042254 ribosome biogenesis
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045732 positive regulation of protein catabolic process
GO:0048511 rhythmic process
GO:0051246 regulation of protein metabolic process
GO:0097193 intrinsic apoptotic signaling pathway
GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
GO:1900087 positive regulation of G1/S transition of mitotic cell cycle
GO:2000001 regulation of DNA damage checkpoint
GO:2000819 regulation of nucleotide-excision repair
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0031461 cullin-RING ubiquitin ligase complex
GO:0031464 Cul4A-RING E3 ubiquitin ligase complex
GO:0080008 Cul4-RING E3 ubiquitin ligase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4a0k, PDBe:4a0k, PDBj:4a0k
PDBsum4a0k
PubMed22118460
UniProtQ13619|CUL4A_HUMAN Cullin-4A (Gene Name=CUL4A)

[Back to BioLiP]