Structure of PDB 3zvy Chain A Binding Site BS01

Receptor Information
>3zvy Chain A (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPL
SSVPSEDEWYCPECR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zvy The Phd Finger of Human Uhrf1 Reveals a New Subgroup of Unmethylated Histone H3 Tail Readers.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		P327 Q330 L331 M332 E355
Binding residue
(residue number reindexed from 1)		P28 Q31 L32 M33 E56
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:3zvy, PDBe:3zvy, PDBj:3zvy
PDBsum3zvy
PubMed22096602
UniProtQ96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 (Gene Name=UHRF1)

[Back to BioLiP]