Structure of PDB 3zrz Chain A Binding Site BS01

Receptor Information
>3zrz Chain A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHE
GGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI
Ligand information
>3zrz Chain C (length=18) Species: 1314 (Streptococcus pyogenes) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TGMSGFSETVTIVEDTRP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zrz Structural and Functional Analysis of the Tandem Beta-Zipper Interaction of a Streptococcal Protein with Human Fibronectin.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
W90 R99 G100 R101 I102 S103 C104 T105 I106 C110 H111 E112 R125 H127 Y132 L134 K143 G144 E145 W146 T147 C148
Binding residue
(residue number reindexed from 1)
W28 R37 G38 R39 I40 S41 C42 T43 I44 C48 H49 E50 R63 H65 Y70 L72 K81 G82 E83 W84 T85 C86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:3zrz, PDBe:3zrz, PDBj:3zrz
PDBsum3zrz
PubMed21840989
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]