Structure of PDB 3zrj Chain A Binding Site BS01

Receptor Information
>3zrj Chain A (length=160) Species: 345076 (Vibrio cholerae V52) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHTDPIRIELPTLIAKLNAQSKLALEQAASLCIERQHPEVTLEHYLDVLL
DNPLSDVRLVLKQAGLEVDQVKQAIASTYSREQVTYPAFSPLLVELLQEA
WLLSSTELEQAELRSGAIFLAALTRADRYLSFKLISLFEGINRENLKKHF
AMILSDSAET
Ligand information
>3zrj Chain X (length=14) Species: 345076 (Vibrio cholerae V52) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QGSLLDEIMAQTRC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zrj Molecular Basis for the Unique Role of the Aaa+ Chaperone Clpv in Type Vi Protein Secretion.
Resolution1.94 Å
Binding residue
(original residue number in PDB)		P7 I10 E22 S26 I29 Y84 P85 A86 F87
Binding residue
(residue number reindexed from 1)		P11 I14 E26 S30 I33 Y86 P87 A88 F89
External links