Structure of PDB 3zqh Chain A Binding Site BS01

Receptor Information
>3zqh Chain A (length=204) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRAL
LDALAIEMLDRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHRDGAKVHL
GTRPTEKQYETLENQLAFLTQQGFSLENALYALSAVGHFTLGSVLEDQEH
QVAKEERETPTTDSMPPLLRQAIELFDHQGAEPAFLHGLESLIRGFEVQL
TALL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zqh An Exclusive Alpha/Beta Code Directs Allostery in Tetr-Peptide Complexes.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		H64 F67 N82 F86 R104 P105 Q109 Q116 L134 G138 H139 L142
Binding residue
(residue number reindexed from 1)		H63 F66 N81 F85 R103 P104 Q108 Q115 L133 G137 H138 L141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zqh, PDBe:3zqh, PDBj:3zqh
PDBsum3zqh
PubMed22178479
UniProtP04483|TETR2_ECOLX Tetracycline repressor protein class B from transposon Tn10 (Gene Name=tetR);
P0ACT4|TETR4_ECOLX Tetracycline repressor protein class D (Gene Name=tetR)

[Back to BioLiP]