Structure of PDB 3zqf Chain A Binding Site BS01

Receptor Information
>3zqf Chain A (length=183) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL
DALAIEMLDRHHTHESWQDFLRNNAKSFRNALLSHRDGAKVHLGTRPTEK
QYETLENQLAFLTQQGFSLENALYALSAVGHFTLGSVLEDQEHMPPLLRQ
AIELFDHQGAEPAFLHGLESLIRGFEVQLTALL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zqf An Exclusive Alpha/Beta Code Directs Allostery in Tetr-Peptide Complexes.
Resolution2.56 Å
Binding residue
(original residue number in PDB)		H64 F86 H100 G102 T103 P105 Q109 Y110 T112 L113 Q116 S135
Binding residue
(residue number reindexed from 1)		H62 F78 H92 G94 T95 P97 Q101 Y102 T104 L105 Q108 S127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zqf, PDBe:3zqf, PDBj:3zqf
PDBsum3zqf
PubMed22178479
UniProtP04483|TETR2_ECOLX Tetracycline repressor protein class B from transposon Tn10 (Gene Name=tetR);
P0ACT4|TETR4_ECOLX Tetracycline repressor protein class D (Gene Name=tetR)

[Back to BioLiP]