Structure of PDB 3zhm Chain A Binding Site BS01

Receptor Information

>3zhm Chain A (length=79) Species: 35345 (Lactococcus phage TP901-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KTDTSNRLKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSQYVNSVQ
SPDQNRIYLLAKTLGVSEAWLMGRSHHHH

Ligand information

>3zhm Chain B (length=9) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agttcacgt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3zhm Binding of the N-Terminal Domain of the Lactococcal Bacteriophage Tp901-1 Ci Repressor to its Target DNA: A Crystallography, Small Angle Scattering, and Nuclear Magnetic Resonance Study.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	Q20 V21 K40 S44 N48
Binding residue (residue number reindexed from 1)	Q19 V20 K39 S43 N47

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:3zhm, PDBe:3zhm, PDBj:3zhm
PDBsum	3zhm
PubMed	24047404
UniProt	O48503

[Back to BioLiP]