Structure of PDB 3zfw Chain A Binding Site BS01

Receptor Information

>3zfw Chain A (length=226) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQ
NQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDA
ETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREESACKVDSPTVNTTLR
SLGALYRRQGKLEAAHTLEDCASRSR

Ligand information

>3zfw Chain X (length=11) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TNLEWDDSAIT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3zfw Structural Basis for Kinesin-1:Cargo Recognition.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	R251 A283 N286 N287 V290 L291 K294 R312 K325 N329 L332 L333 N336
Binding residue (residue number reindexed from 1)	R16 A48 N51 N52 V55 L56 K59 R77 K90 N94 L97 L98 N101

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Cellular Component
GO:0005871	kinesin complex

View graph for
Cellular Component

External links

PDB	RCSB:3zfw, PDBe:3zfw, PDBj:3zfw
PDBsum	3zfw
PubMed	23519214
UniProt	O88448\|KLC2_MOUSE Kinesin light chain 2 (Gene Name=Klc2)

[Back to BioLiP]