Structure of PDB 3zdd Chain A Binding Site BS01

Receptor Information
>3zdd Chain A (length=247) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVHLLIVDALNLIRRIHAVQGSPCVETCQHALDQLIMHSQPTHAVAVFDD
RSSGWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTGNEAD
DLAATLAVKVTQAGHQATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFI
DKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSATQLLVEFQSLEGIY
ENLDAVAEKWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLVR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3zdd The structure of Escherichia coli ExoIX--implications for DNA binding and catalysis in flap endonucleases.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		A183 G184 G186 P187 K188 S189
Binding residue
(residue number reindexed from 1)		A179 G180 G182 P183 K184 S185
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0004519 endonuclease activity
GO:0008409 5'-3' exonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
GO:0017108 5'-flap endonuclease activity
GO:0030955 potassium ion binding
GO:0046872 metal ion binding
GO:0048256 flap endonuclease activity
Biological Process
GO:0033567 DNA replication, Okazaki fragment processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zdd, PDBe:3zdd, PDBj:3zdd
PDBsum3zdd
PubMed23821668
UniProtQ8X6R9|XNI_ECO57 Flap endonuclease Xni (Gene Name=xni)

[Back to BioLiP]