Structure of PDB 3zbv Chain A Binding Site BS01

Receptor Information

>3zbv Chain A (length=118) Species: 10090 (Mus musculus)

DSRYTKFLTQHYDAKPKGRDDRYCESMMVKRKLTSFCKDVNTFIHDTKNN
IKAICGKKGSPYGRNLRISKSHFQVTTCTHKGRSPRPPCRYRASKGFRYI
IIGCENGWPVHFDESFIS

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 3zbv Chain A Residue 1121

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3zbv Crystal Structures of Murine Angiogenin-2 and -3 - Probing 'Structure - Function' Relationships Amongst Angiogenin Homologues.
• Resolution: 1.64 Å
• Binding residue (original residue number in PDB): D41 H82
• Binding residue (residue number reindexed from 1): D39 H80
• Annotation score: 4

Enzymatic activity

• Catalytic site (original residue number in PDB): H13 K40 H113 F114 D115
• Catalytic site (residue number reindexed from 1): H11 K38 H111 F112 D113

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0003300 cardiac muscle hypertrophy
• GO:0010467 gene expression
• GO:0038166 angiotensin-activated signaling pathway
• GO:0061049 cell growth involved in cardiac muscle cell development
• GO:0070293 renal absorption
• GO:0070528 protein kinase C signaling
• GO:0071333 cellular response to glucose stimulus

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0031410 cytoplasmic vesicle

External links

• PDB: RCSB:3zbv, PDBe:3zbv, PDBj:3zbv
• PDBsum: 3zbv
• PubMed: 23170778
• UniProt: Q64438|ANG2_MOUSE Angiogenin-2 (Gene Name=Ang2)