Structure of PDB 3wuu Chain A Binding Site BS01

Receptor Information
>3wuu Chain A (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMGSFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFEL
EKKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wuu Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells.
Resolution2.904 Å
Binding residue
(original residue number in PDB)		Q173 D176 K180 Q183 W184 Y187 Q190 R191 Y194
Binding residue
(residue number reindexed from 1)		Q18 D21 K25 Q28 W29 Y32 Q35 R36 Y39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000281 mitotic cytokinesis
GO:0051896 regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

View graph for
Biological Process
External links
PDB RCSB:3wuu, PDBe:3wuu, PDBj:3wuu
PDBsum3wuu
PubMed26392564
UniProtQ53EZ4|CEP55_HUMAN Centrosomal protein of 55 kDa (Gene Name=CEP55)

[Back to BioLiP]