Structure of PDB 3wut Chain A Binding Site BS01

Receptor Information

>3wut Chain A (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKK
TET

Ligand information

>3wut Chain C (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LAVGPPSLNYIPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3wut Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells.
Resolution	2.301 Å
Binding residue (original residue number in PDB)	Q173 A177 K180 Q183 W184 Y187 Q190 R191 Y194
Binding residue (residue number reindexed from 1)	Q15 A19 K22 Q25 W26 Y29 Q32 R33 Y36

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0000281	mitotic cytokinesis
GO:0051896	regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

View graph for
Biological Process

External links

PDB	RCSB:3wut, PDBe:3wut, PDBj:3wut
PDBsum	3wut
PubMed	26392564
UniProt	Q53EZ4\|CEP55_HUMAN Centrosomal protein of 55 kDa (Gene Name=CEP55)

[Back to BioLiP]