Structure of PDB 3wsr Chain A Binding Site BS01

Receptor Information
>3wsr Chain A (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PCDTNWRYYGDSCYGFFRHNLTWEESKQYCTDMNATLLKIDNRNIVEYIK
ARTHLIRWVGLSRQKSNEVWKWEDGSVISENMFEFLEDGKGNMNCAYFHN
GKMHPTFCENKHYLMCERKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wsr A Platform of C-type Lectin-like Receptor CLEC-2 for Binding O-Glycosylated Podoplanin and Nonglycosylated Rhodocytin
Resolution1.91 Å
Binding residue
(original residue number in PDB)
R107 F116 R118 R152 T153 H154 L155
Binding residue
(residue number reindexed from 1)
R7 F16 R18 R52 T53 H54 L55
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3wsr, PDBe:3wsr, PDBj:3wsr
PDBsum3wsr
PubMed25458834
UniProtQ9P126|CLC1B_HUMAN C-type lectin domain family 1 member B (Gene Name=CLEC1B)

[Back to BioLiP]