Structure of PDB 3wdd Chain A Binding Site BS01

Receptor Information
>3wdd Chain A (length=147) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE
SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH
NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wdd Structural basis of mycobacterial inhibition by cyclomarin A
Resolution1.18 Å
Binding residue
(original residue number in PDB)
M1 Y2 H77 I78 P79 F80 K85 E89
Binding residue
(residue number reindexed from 1)
M1 Y2 H77 I78 P79 F80 K85 E89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3wdd, PDBe:3wdd, PDBj:3wdd
PDBsum3wdd
PubMed24022489
UniProtP9WPC9|CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 (Gene Name=clpC1)

[Back to BioLiP]