Structure of PDB 3wbm Chain A Binding Site BS01

Receptor Information
>3wbm Chain A (length=86) Species: 2286 (Saccharolobus shibatae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVE
IVRNRFLPDKIEIKEIRVGSQVVSRVSTIEIAIRKK
Ligand information
>3wbm Chain X (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguaagagcacccgacugcucuucc
.........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wbm Biochemical and structural insights into RNA binding by Ssh10b, a member of the highly conserved Sac10b protein family in Archaea.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G15 K16 K17 Y22 R42 R44
Binding residue
(residue number reindexed from 1)		G11 K12 K13 Y18 R38 R40
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0004518 nuclease activity
Biological Process
GO:0030261 chromosome condensation
Cellular Component
GO:0005694 chromosome
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wbm, PDBe:3wbm, PDBj:3wbm
PDBsum3wbm
PubMed24307170
UniProtP60848|ALBA1_SACSH DNA/RNA-binding protein Alba 1 (Gene Name=albA1)

[Back to BioLiP]