Structure of PDB 3wa4 Chain A Binding Site BS01

Receptor Information
>3wa4 Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEFWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQ
HFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3wa4 High Resolution Crystal Structure of the Grb2 SH2 Domain with a Phosphopeptide Derived from CD28
Resolution1.35 Å
Binding residue
(original residue number in PDB)
R67 R86 S88 S90 S96 H107 F108 K109 L120 W121
Binding residue
(residue number reindexed from 1)
R11 R30 S32 S34 S40 H51 F52 K53 L64 W65
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3wa4, PDBe:3wa4, PDBj:3wa4
PDBsum3wa4
PubMed24098653
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]