Structure of PDB 3w6v Chain A Binding Site BS01

Receptor Information
>3w6v Chain A (length=111) Species: 1911 (Streptomyces griseus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDPLAEVVAWALEHLHEQFDVETLAARAYMSRRTFDRRFRSLTGSAPLQW
LITQRVLQAQRLLETSDYSVDEVAGRCGFRSPVALRGHFRRQLGSSPAAY
RAAYRARRPQG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3w6v Complex Structure of the DNA-binding Domain of AdpA, the Global Transcription Factor in Streptomyces griseus, and a Target Duplex DNA Reveals the Structural Basis of Its Tolerant DNA Sequence Specificity
Resolution2.95 Å
Binding residue
(original residue number in PDB)		D249 V250 R261 R262 D265 R269 A275 L277
Binding residue
(residue number reindexed from 1)		D20 V21 R32 R33 D36 R40 A46 L48
Binding affinityPDBbind-CN: Kd=2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3w6v, PDBe:3w6v, PDBj:3w6v
PDBsum3w6v
PubMed24019524
UniProtQ9S166

[Back to BioLiP]