Structure of PDB 3w5r Chain A Binding Site BS01

Receptor Information

>3w5r Chain A (length=242) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMSPLSMLPHLADLV
SYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDM
SWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLM
AICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMI
QKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNEI

Ligand information

>3w5r Chain C (length=11) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KNHPMLMNLLK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3w5r Crystal structures of complexes of vitamin D receptor ligand-binding domain with lithocholic acid derivatives.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	I238 K242 Q255 I256 L259 K260 P412 E416
Binding residue (residue number reindexed from 1)	I58 K62 Q75 I76 L79 K80 P232 E236

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3w5r, PDBe:3w5r, PDBj:3w5r
PDBsum	3w5r
PubMed	23723390
UniProt	P13053\|VDR_RAT Vitamin D3 receptor (Gene Name=Vdr)

[Back to BioLiP]