Structure of PDB 3w1s Chain A Binding Site BS01

Receptor Information
>3w1s Chain A (length=261) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDIKQLLWNGELNVLVSIDPSFLMKGSPREIAVLRIRVPRETYLVNYMPL
IWNKIKSFLSFDPLTDSEKYFWFEHNKTPIPWNYPVGVLFDCLADVLTFL
RIHLVMGDSLPPTIIPIAKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVN
EARKFWGSVITRNFQDFIEISNKISSSRPRHIPLIIQTSRTSGTFRISQP
TISMTGVNPTLKDIEGDILDVKEDVMVICQGIEIPWHMLLYDLYSKLRSF
DGFLYITLVPI
Ligand information
>3w1s Chain B (length=25) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DSMDDLLIRRLTDRNDKEAHLNELF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3w1s Structure of the Atg12-Atg5 conjugate reveals a platform for stimulating Atg8-PE conjugation
Resolution2.6 Å
Binding residue
(original residue number in PDB)		I4 L7 G11 L13 N14 V15 R36 R41 D111 L113 Q253 I255 E256 M261 K269
Binding residue
(residue number reindexed from 1)		I3 L6 G10 L12 N13 V14 R35 R40 D95 L97 Q230 I232 E233 M238 K246
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0016787 hydrolase activity
GO:0019776 Atg8-family ligase activity
GO:0140355 cargo receptor ligand activity
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0000423 mitophagy
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0015031 protein transport
GO:0016236 macroautophagy
GO:0032258 cytoplasm to vacuole targeting by the Cvt pathway
GO:0034727 piecemeal microautophagy of the nucleus
GO:0044804 nucleophagy
GO:0051365 cellular response to potassium ion starvation
Cellular Component
GO:0000407 phagophore assembly site
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005776 autophagosome
GO:0005829 cytosol
GO:0016020 membrane
GO:0034045 phagophore assembly site membrane
GO:0034274 Atg12-Atg5-Atg16 complex
GO:0044233 mitochondria-associated endoplasmic reticulum membrane contact site
GO:0061908 phagophore
GO:0120095 vacuole-isolation membrane contact site
GO:1990234 transferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3w1s, PDBe:3w1s, PDBj:3w1s
PDBsum3w1s
PubMed23238393
UniProtQ12380|ATG5_YEAST Autophagy protein 5 (Gene Name=ATG5)

[Back to BioLiP]