Structure of PDB 3w0g Chain A Binding Site BS01

Receptor Information

>3w0g Chain A (length=242) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMSPLSMLPHLAD
LVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMD
DMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVL
LMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAK
MIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN

Ligand information

>3w0g Chain C (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KNHPMLMNLLKD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3w0g Structural basis for vitamin D receptor agonism by novel non-secosteroidal ligands.
Resolution	1.94 Å
Binding residue (original residue number in PDB)	I238 K242 S252 K260 P412 E416
Binding residue (residue number reindexed from 1)	I60 K64 S74 K82 P234 E238

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3w0g, PDBe:3w0g, PDBj:3w0g
PDBsum	3w0g
PubMed	23462137
UniProt	P13053\|VDR_RAT Vitamin D3 receptor (Gene Name=Vdr)

[Back to BioLiP]