Structure of PDB 3vxw Chain A Binding Site BS01

Receptor Information
>3vxw Chain A (length=111) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLV
PADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDK
DGFLYVTYSGE
Ligand information
>3vxw Chain B (length=6) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SWQAIQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vxw Autophagy-related protein 32 acts as autophagic degron and directly initiates mitophagy
Resolution3.0 Å
Binding residue
(original residue number in PDB)		E17 R28 P30 K48 Y49 L50 P52 F104
Binding residue
(residue number reindexed from 1)		E16 R27 P29 K47 Y48 L49 P51 F103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008429 phosphatidylethanolamine binding
GO:0031386 protein tag activity
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0015031 protein transport
GO:0016241 regulation of macroautophagy
GO:0031503 protein-containing complex localization
GO:0032258 cytoplasm to vacuole targeting by the Cvt pathway
GO:0034497 protein localization to phagophore assembly site
GO:0034727 piecemeal microautophagy of the nucleus
GO:0044804 nucleophagy
GO:0061025 membrane fusion
GO:0061709 reticulophagy
GO:0071211 protein targeting to vacuole involved in autophagy
GO:0097352 autophagosome maturation
GO:0140042 lipid droplet formation
GO:1905153 regulation of membrane invagination
Cellular Component
GO:0000329 fungal-type vacuole membrane
GO:0000407 phagophore assembly site
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005773 vacuole
GO:0005776 autophagosome
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle
GO:0031966 mitochondrial membrane
GO:0033110 Cvt vesicle membrane
GO:0120095 vacuole-isolation membrane contact site

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3vxw, PDBe:3vxw, PDBj:3vxw
PDBsum3vxw
PubMed22308029
UniProtP38182|ATG8_YEAST Autophagy-related protein 8 (Gene Name=ATG8)

[Back to BioLiP]