Structure of PDB 3vxv Chain A Binding Site BS01

Receptor Information
>3vxv Chain A (length=65) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPVPCGWERVVKQRLSGKTAGKFDVYFISPQGLKFRSKRSLANYLLKNGE
TFLKPEDFNFTVLPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vxv Structural basis of the versatile DNA recognition ability of the methyl-CpG binding domain of methyl-CpG binding domain protein 4
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R106 S107 K108 R109
Binding residue
(residue number reindexed from 1)		R36 S37 K38 R39
Binding affinityPDBbind-CN: Kd=98.8nM
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3vxv, PDBe:3vxv, PDBj:3vxv
PDBsum3vxv
PubMed23316048
UniProtQ9Z2D7|MBD4_MOUSE Methyl-CpG-binding domain protein 4 (Gene Name=Mbd4)

[Back to BioLiP]