Structure of PDB 3vw4 Chain A Binding Site BS01

Receptor Information
>3vw4 Chain A (length=122) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHHRNYHLFEKVRKWAYRAIRQGWPVFSQWLDAVIQRVEMYNASLPVP
LSPAECRAIGKSIAKYTHRKFSPEGFSAVQAARGRKGGTKSKRAAVPTSA
RSLKPWEALGISRATYYRKLKC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vw4 Structural Basis for Replication Origin Unwinding by An Initiator-Primase of Plasmid ColE2-P9: Duplex DNA Unwinding by A Single Protein
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K185 R189 R252 G253 K255 G256 K259 S260 R262 I280 S281 T284 R287
Binding residue
(residue number reindexed from 1)		K16 R20 R83 G84 K86 G87 K90 S91 R93 I111 S112 T115 R118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:3vw4, PDBe:3vw4, PDBj:3vw4
PDBsum3vw4
PubMed25538245
UniProtQ06B24

[Back to BioLiP]