Structure of PDB 3vu6 Chain A Binding Site BS01

Receptor Information

>3vu6 Chain A (length=38) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ

Ligand information

>3vu6 Chain B (length=24) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MTWEEWDKKIEEYTKKIEELIKKS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3vu6 Short-peptide fusion inhibitors with high potency against wild-type and enfuvirtide-resistant HIV-1
Resolution	2.324 Å
Binding residue (original residue number in PDB)	L556 Q563 Q567 I573 K574 D589 Q590
Binding residue (residue number reindexed from 1)	L4 Q11 Q15 I21 K22 D37 Q38

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:3vu6, PDBe:3vu6, PDBj:3vu6
PDBsum	3vu6
PubMed	23233535
UniProt	P03375\|ENV_HV1B1 Envelope glycoprotein gp160 (Gene Name=env)

[Back to BioLiP]