Structure of PDB 3vqm Chain A Binding Site BS01

Receptor Information
>3vqm Chain A (length=111) Species: 273063 (Sulfurisphaera tokodaii str. 7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKELQKRSEELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARV
SGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYE
NGVLTIRIPIA
Ligand information
>3vqm Chain O (length=5) Species: 273063 (Sulfurisphaera tokodaii str. 7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VIKIE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vqm Structural studies on the oligomeric transition of a small heat shock protein, StHsp14.0
Resolution2.55 Å
Binding residue
(original residue number in PDB)		K47 A52 I99 G101
Binding residue
(residue number reindexed from 1)		K43 A48 I95 G97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051082 unfolded protein binding
Biological Process
GO:0006457 protein folding
GO:0009408 response to heat
GO:0009651 response to salt stress
GO:0042542 response to hydrogen peroxide
GO:0051259 protein complex oligomerization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3vqm, PDBe:3vqm, PDBj:3vqm
PDBsum3vqm
PubMed22613762
UniProtQ970D9

[Back to BioLiP]