Structure of PDB 3vfm Chain A Binding Site BS01

Receptor Information
>3vfm Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEARRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vfm The Energetic Basis Underpinning T-cell Receptor Recognition of a Super-bulged Peptide Bound to a Major Histocompatibility Complex Class I Molecule.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y7 N63 I66 F67 T69 N70 T73 Y74 E76 S77 Y84 R97 Y99 S116 T143 K146 W147 V152 R156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 N63 I66 F67 T69 N70 T73 Y74 E76 S77 Y84 R97 Y99 S116 T143 K146 W147 V152 R156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links