Structure of PDB 3veb Chain A Binding Site BS01

Receptor Information
>3veb Chain A (length=146) Species: 632 (Yersinia pestis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEP
VKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVW
QRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3veb Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y30 K33 K34 R82 Q85 T86 R90 R93 R103 K105 I107 D108
Binding residue
(residue number reindexed from 1)		Y16 K19 K20 R68 Q71 T72 R76 R79 R89 K91 I93 D94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3veb, PDBe:3veb, PDBj:3veb
PDBsum3veb
PubMed23084832
UniProtQ8ZG78|MATP_YERPE Macrodomain Ter protein (Gene Name=matP)

[Back to BioLiP]