Structure of PDB 3vah Chain A Binding Site BS01

Receptor Information
>3vah Chain A (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQIN
QDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLF
IGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINV
TDQAIAGLNGMQLGDKKLLVQRAS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vah U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		R150 Y152 N155 Q190 I191 N192 K195 F197 F199 K225 R228 P229 H230 D231
Binding residue
(residue number reindexed from 1)		R8 Y10 N13 Q48 I49 N50 K53 F55 F57 K83 R86 P87 H88 D89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3vah, PDBe:3vah, PDBj:3vah
PDBsum3vah
PubMed23376934
UniProtP26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]