Structure of PDB 3v9w Chain A Binding Site BS01

Receptor Information

>3v9w Chain A (length=202) Species: 83333 (Escherichia coli K-12)

GLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTL
HFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIK
ASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLA
LGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWP
LS

Ligand information

>3v9w Chain E (length=3)

tta

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3v9w How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
• Resolution: 1.702 Å
• Binding residue (original residue number in PDB): E25 T26 F29 A74 F77 N78 H120 N121 F124 V163 L164
• Binding residue (residue number reindexed from 1): E17 T18 F21 A66 F69 N70 H112 N113 F116 V155 L156

Enzymatic activity

• Enzyme Commision number: 3.1.13.-

Gene Ontology

Molecular Function

• GO:0000175 3'-5'-RNA exonuclease activity
• GO:0000287 magnesium ion binding
• GO:0003676 nucleic acid binding
• GO:0004527 exonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0008310 single-stranded DNA 3'-5' DNA exonuclease activity
• GO:0008408 3'-5' exonuclease activity
• GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006396 RNA processing
• GO:0006974 DNA damage response
• GO:0008033 tRNA processing
• GO:0031125 rRNA 3'-end processing
• GO:0034644 cellular response to UV
• GO:0042780 tRNA 3'-end processing
• GO:0043628 regulatory ncRNA 3'-end processing
• GO:0045004 DNA replication proofreading

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3v9w, PDBe:3v9w, PDBj:3v9w
• PDBsum: 3v9w
• PubMed: 22718982
• UniProt: P30014|RNT_ECOLI Ribonuclease T (Gene Name=rnt)