Structure of PDB 3v43 Chain A Binding Site BS01

Receptor Information
>3v43 Chain A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVR
VKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMP
KGMWICQICRPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3v43 Combinatorial readout of unmodified H3R2 and acetylated H3K14 by the tandem PHD finger of MOZ reveals a regulatory mechanism for HOXA9 transcription
Resolution1.47 Å
Binding residue
(original residue number in PDB)
I260 A275 N277 M278 L279 F280 C281 D282 D285 M300 P301 G303
Binding residue
(residue number reindexed from 1)
I59 A74 N76 M77 L78 F79 C80 D81 D84 M99 P100 G102
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
External links
PDB RCSB:3v43, PDBe:3v43, PDBj:3v43
PDBsum3v43
PubMed22713874
UniProtQ92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)

[Back to BioLiP]