Structure of PDB 3v3b Chain A Binding Site BS01

Receptor Information
>3v3b Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQH
IVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3v3b Structure of the stapled p53 peptide bound to Mdm2.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		L54 G58 I61 M62 Y67 Q72 H73 V93 Y100
Binding residue
(residue number reindexed from 1)		L31 G35 I38 M39 Y44 Q49 H50 V70 Y77
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3v3b, PDBe:3v3b, PDBj:3v3b
PDBsum3v3b
PubMed22148351
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]