Structure of PDB 3v31 Chain A Binding Site BS01

Receptor Information
>3v31 Chain A (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIA
VVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDW
NGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSV
QQVIESHLLKLLQNIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3v31 Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock.
Resolution1.57 Å
Binding residue
(original residue number in PDB)
Q155 Q159 F183 W188 H192 S220 L221 Y254 H257 L287
Binding residue
(residue number reindexed from 1)
Q9 Q13 F37 W42 H46 S74 L75 Y108 H111 L141
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3v31, PDBe:3v31, PDBj:3v31
PDBsum3v31
PubMed22649097
UniProtQ9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 (Gene Name=ANKRA2)

[Back to BioLiP]