Structure of PDB 3uw4 Chain A Binding Site BS01

Receptor Information
>3uw4 Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQTHAARMRTFMYWPSSVPVQPEQLAAAGFYYVGRNDDVKCFSCDGGLRC
WESGDDPWVEHAKWFPGCEFLIRMKGQEYINNIHLTH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3uw4 Discovery of a Potent Small-Molecule Antagonist of Inhibitor of Apoptosis (IAP) Proteins and Clinical Candidate for the Treatment of Cancer (GDC-0152).
Resolution1.79 Å
Binding residue
(original residue number in PDB)
G298 L299 R300 C301 W302 E303 D306 E311 W315
Binding residue
(residue number reindexed from 1)
G47 L48 R49 C50 W51 E52 D55 E60 W64
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:3uw4, PDBe:3uw4, PDBj:3uw4
PDBsum3uw4
PubMed22413863
UniProtP98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP (Gene Name=XIAP);
Q13490|BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 (Gene Name=BIRC2)

[Back to BioLiP]