Structure of PDB 3uw4 Chain A Binding Site BS01

Receptor Information

>3uw4 Chain A (length=87) Species: 9606 (Homo sapiens)

MQTHAARMRTFMYWPSSVPVQPEQLAAAGFYYVGRNDDVKCFSCDGGLRC
WESGDDPWVEHAKWFPGCEFLIRMKGQEYINNIHLTH

Ligand information

>3uw4 Chain Z (length=3)

AGP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3uw4 Discovery of a Potent Small-Molecule Antagonist of Inhibitor of Apoptosis (IAP) Proteins and Clinical Candidate for the Treatment of Cancer (GDC-0152).
• Resolution: 1.79 Å
• Binding residue (original residue number in PDB): G298 L299 R300 C301 W302 E303 D306 E311 W315
• Binding residue (residue number reindexed from 1): G47 L48 R49 C50 W51 E52 D55 E60 W64

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

External links

• PDB: RCSB:3uw4, PDBe:3uw4, PDBj:3uw4
• PDBsum: 3uw4
• PubMed: 22413863
• UniProt: P98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP (Gene Name=XIAP);
  Q13490|BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 (Gene Name=BIRC2)