Structure of PDB 3upv Chain A Binding Site BS01

Receptor Information
>3upv Chain A (length=125) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAK
LMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAART
KDAEVNNGSSAREIDQLYYKASQQR
Ligand information
>3upv Chain B (length=7) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PTVEEVD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3upv The architecture of functional modules in the Hsp90 co-chaperone Sti1/Hop.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R266 F273 Y285 R297 N301 K308 F329 R331 I334 R335 E371
Binding residue
(residue number reindexed from 1)		R8 F15 Y27 R39 N43 K50 F71 R73 I76 R77 E113
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3upv, PDBe:3upv, PDBj:3upv
PDBsum3upv
PubMed22227520
UniProtP15705|STI1_YEAST Heat shock protein STI1 (Gene Name=STI1)

[Back to BioLiP]