Structure of PDB 3up0 Chain A Binding Site BS01

Receptor Information
>3up0 Chain A (length=242) Species: 53326 (Ancylostoma ceylanicum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYQLNAAELQALDLIQEAFKGMNDPMEQGRQATSFLKNEKSPADIMNIMD
VTMRRFVKMAKRLPAFNDLSQDGKFALLKGGMIEMLTVRGVRRFDSSSGS
WTTPTLGESSEVSINMFDQLNADVRSEQKMRFLQFFKIFHEDIRSNDLVI
SMIMLIVLFSPRDSITDPEDRRIIARHHEQFSALLNRYLESLYGDDAHQL
NEQLPTALRMLREISASSGMLFLGTVNTSEAEPLPREFFKVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3up0 Structural Conservation of Ligand Binding Reveals a Bile Acid-like Signaling Pathway in Nematodes.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		V500 K504 Q514 D515 K517 F518 K522 L677 E680
Binding residue
(residue number reindexed from 1)		V57 K61 Q71 D72 K74 F75 K79 L234 E237
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
GO:0046872 metal ion binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0030154 cell differentiation
GO:0030522 intracellular receptor signaling pathway
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3up0, PDBe:3up0, PDBj:3up0
PDBsum3up0
PubMed22170062
UniProtH0USY8

[Back to BioLiP]