Structure of PDB 3uot Chain A Binding Site BS01

Receptor Information
>3uot Chain A (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPF
PSISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQ
ELILFADLLCQYHRLDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3uot The molecular basis of ATM-dependent dimerization of the Mdc1 DNA damage checkpoint mediator.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
R58 P69 S70 I71 S72 K73 L95 N96 D125
Binding residue
(residue number reindexed from 1)
R40 P51 S52 I53 S54 K55 L77 N78 D107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3uot, PDBe:3uot, PDBj:3uot
PDBsum3uot
PubMed22234878
UniProtQ14676|MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 (Gene Name=MDC1)

[Back to BioLiP]