Structure of PDB 3umx Chain A Binding Site BS01

Receptor Information

>3umx Chain A (length=261) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QYQVGPLLGSGGFGSVYSGIRVNLPVAIKHVEKDRISDWGERVPMEVVLL
KKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEEL
ARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALL
KDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFE
HDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDV
LLPQETAEIHL

Ligand information

Ligand ID

Q18

InChI

InChI=1S/C24H24N2O3/c27-21-10-9-18-23(28)22(13-16-14-25-20-8-4-3-7-17(16)20)29-24(18)19(21)15-26-11-5-1-2-6-12-26/h3-4,7-10,13-14,25,27H,1-2,5-6,11-12,15H2/b22-13-

InChIKey

IARYZBOIUVHJGF-XKZIYDEJSA-N

SMILES

Software	SMILES
CACTVS 3.370	Oc1ccc2C(=O)C(Oc2c1CN3CCCCCC3)=Cc4c[nH]c5ccccc45
ACDLabs 12.01	O=C1c4ccc(O)c(c4O/C1=C\c3c2ccccc2nc3)CN5CCCCCC5
OpenEye OEToolkits 1.7.6	c1ccc2c(c1)c(c[nH]2)/C=C\3/C(=O)c4ccc(c(c4O3)CN5CCCCCC5)O
CACTVS 3.370	Oc1ccc2C(=O)C(/Oc2c1CN3CCCCCC3)=C/c4c[nH]c5ccccc45
OpenEye OEToolkits 1.7.6	c1ccc2c(c1)c(c[nH]2)C=C3C(=O)c4ccc(c(c4O3)CN5CCCCCC5)O

Formula

C24 H24 N2 O3

Name

(2Z)-7-(azepan-1-ylmethyl)-6-hydroxy-2-(1H-indol-3-ylmethylidene)-1-benzofuran-3(2H)-one

PDB chain

3umx Chain A Residue 400 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3umx Flexibility of the P-loop of Pim-1 kinase: observation of a novel conformation induced by interaction with an inhibitor
Resolution	2.55 Å
Binding residue (original residue number in PDB)	L44 F49 V52 A65 K67 L120 E121 E171 L174 D186
Binding residue (residue number reindexed from 1)	L8 F13 V16 A27 K29 L77 E78 E128 L131 D143
Annotation score	1
Binding affinity	PDBbind-CN: -logKd/Ki=6.62,IC50=0.24uM BindingDB: IC50=410nM

Enzymatic activity

Catalytic site (original residue number in PDB)	D167 K169 N172 D186 L193 T204
Catalytic site (residue number reindexed from 1)	D124 K126 N129 D143 L150 T161
Enzyme Commision number	2.7.11.1: non-specific serine/threonine protein kinase.

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0008134	transcription factor binding
GO:0030145	manganese ion binding
GO:0043024	ribosomal small subunit binding
GO:0044024	histone H2AS1 kinase activity
GO:0046872	metal ion binding
GO:0106310	protein serine kinase activity

	Biological Process
GO:0006338	chromatin remodeling
GO:0006468	protein phosphorylation
GO:0006915	apoptotic process
GO:0016310	phosphorylation
GO:0022898	regulation of transmembrane transporter activity
GO:0043066	negative regulation of apoptotic process
GO:0043433	negative regulation of DNA-binding transcription factor activity
GO:0045824	negative regulation of innate immune response
GO:0045893	positive regulation of DNA-templated transcription
GO:0046777	protein autophosphorylation
GO:0050821	protein stabilization
GO:0060045	positive regulation of cardiac muscle cell proliferation
GO:0070561	vitamin D receptor signaling pathway
GO:0071346	cellular response to type II interferon
GO:0090336	positive regulation of brown fat cell differentiation
GO:1902033	regulation of hematopoietic stem cell proliferation
GO:1904263	positive regulation of TORC1 signaling
GO:1905062	positive regulation of cardioblast proliferation
GO:1990748	cellular detoxification

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3umx, PDBe:3umx, PDBj:3umx
PDBsum	3umx
PubMed	22869110
UniProt	P11309\|PIM1_HUMAN Serine/threonine-protein kinase pim-1 (Gene Name=PIM1)

[Back to BioLiP]