Structure of PDB 3ukg Chain A Binding Site BS01

Receptor Information
>3ukg Chain A (length=223) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRV
YLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAI
AVKKQFYRDLFQIDPDTGRSPNHVPGSEPNFAAYRTQSRRGPIAREFFKH
FAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLT
NRPKRPGVPTPGNYNSAAKRARN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ukg The orientation of the C-terminal domain of the Saccharomyces cerevisiae Rap1 protein is determined by its binding to DNA.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		K360 A361 S362 F363 H385 H398 T399 N401 S402 H405 R406 Y410 K446 R447 F449 H536 T537 N539 D543 R544 F548 N576 T578 T588 P589 G590 N591 N593 S594
Binding residue
(residue number reindexed from 1)		K1 A2 S3 F4 H26 H39 T40 N42 S43 H46 R47 Y51 K87 R88 F90 H158 T159 N161 D165 R166 F170 N198 T200 T210 P211 G212 N213 N215 S216
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3ukg, PDBe:3ukg, PDBj:3ukg
PDBsum3ukg
PubMed22139930
UniProtP11938|RAP1_YEAST DNA-binding protein RAP1 (Gene Name=RAP1)

[Back to BioLiP]