Structure of PDB 3ugo Chain A Binding Site BS01

Receptor Information
>3ugo Chain A (length=180) Species: 271 (Thermus aquaticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQEL
IREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHI
AREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEK
FEYKRRFKFSTYATWWIRQAINRAIADQAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ugo Structural basis for promoter-10 element recognition by the bacterial RNA polymerase sigma subunit.
Resolution2.096 Å
Binding residue
(original residue number in PDB)		L108 N206 R208 L209 S212 K215 K241 F242 R246 F248 K249 S251 T252 Y253 T255 W256 W257
Binding residue
(residue number reindexed from 1)		L17 N115 R117 L118 S121 K124 K150 F151 R155 F157 K158 S160 T161 Y162 T164 W165 W166
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016987 sigma factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3ugo, PDBe:3ugo, PDBj:3ugo
PDBsum3ugo
PubMed22136875
UniProtQ9EZJ8|SIGA_THEAQ RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]