Structure of PDB 3uby Chain A Binding Site BS01

Receptor Information
>3uby Chain A (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHMTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLG
PEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACV
LLRALEPLEGLETMRQLRSTLLKDRELCSGPSKLCQALAINKSFDQRDLA
QDEAVWLERGPLEPSEPAVVAAARVGVAGEWARKPLRFYVRGSPWVSVVD
RVAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3uby Searching for DNA lesions: structural evidence for lower- and higher-affinity DNA binding conformations of human alkyladenine DNA glycosylase.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y127 H136 M149 Y159 I161 Y162 Y165 C167 N169 L180 R197 G217 P218 S219 K220 V262 G263
Binding residue
(residue number reindexed from 1)		Y48 H57 M70 Y80 I82 Y83 Y86 C88 N90 L101 R118 G130 P131 S132 K133 V175 G176
Binding affinityPDBbind-CN: Kd=21nM
Enzymatic activity
Enzyme Commision number 3.2.2.21: DNA-3-methyladenine glycosylase II.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0003905 alkylbase DNA N-glycosylase activity
Biological Process
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3uby, PDBe:3uby, PDBj:3uby
PDBsum3uby
PubMed22148158
UniProtP29372|3MG_HUMAN DNA-3-methyladenine glycosylase (Gene Name=MPG)

[Back to BioLiP]