Structure of PDB 3u6k Chain A Binding Site BS01

Receptor Information

>3u6k Chain A (length=386) Species: 83333 (Escherichia coli K-12)

TKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKA
RGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAA
TDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELL
SQYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAID
KPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKETQKSTCTG
VEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESE
VYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIK
MVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG

Ligand information

>3u6k Chain C (length=12) Species: 35762 (Planobispora rosea)

SCNCVCGFCCSC

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3u6k Antibacterial optimization of 4-aminothiazolyl analogues of the natural product GE2270 A: identification of the cycloalkylcarboxylic acids.
• Resolution: 2.45 Å
• Binding residue (original residue number in PDB): E215 D216 F218 T228 G257 E259 F261 R262 N273 V274 G275
• Binding residue (residue number reindexed from 1): E208 D209 F211 T221 G250 E252 F254 R255 N266 V267 G268

Enzymatic activity

• Catalytic site (original residue number in PDB): D21 K24 T25 T61 H84
• Catalytic site (residue number reindexed from 1): D14 K17 T18 T54 H77

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0097216 guanosine tetraphosphate binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0032045 guanyl-nucleotide exchange factor complex

External links

• PDB: RCSB:3u6k, PDBe:3u6k, PDBj:3u6k
• PDBsum: 3u6k
• PubMed: 21999529
• UniProt: P0CE47|EFTU1_ECOLI Elongation factor Tu 1 (Gene Name=tufA)